Lineage for d1vjna_ (1vjn A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420456Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 420457Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (4 families) (S)
  5. 420524Family d.157.1.4: Hypothetical protein TM0207 [103317] (1 protein)
  6. 420525Protein Hypothetical protein TM0207 [103318] (1 species)
  7. 420526Species Thermotoga maritima [TaxId:243274] [103319] (1 PDB entry)
  8. 420527Domain d1vjna_: 1vjn A: [100825]

Details for d1vjna_

PDB Entry: 1vjn (more details), 2 Å

PDB Description: Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 A resolution

SCOP Domain Sequences for d1vjna_:

Sequence, based on SEQRES records: (download)

>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima}
hmkitwfghacfalemegktivtdpfdesvgypipnvtadvvteshqhfdhnahhlvkgn
frvidrpgaytvngvkikgvetfhdpshgrergknivfvfegegikvchlgdlghvltpa
qveeigeidvllvpvggtytigpkeakevadllnakviipmhyktkylkfnllpvddflk
lfdsyervgnilelfekpkerkvvvmevq

Sequence, based on observed residues (ATOM records): (download)

>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima}
hmkitwfghacfalemegktivtdpfdpipnvtadvvteshqhnahhlvkgnfrvidrpg
aytvngvkikgvetfhdgknivfvfegegikvchlgdlghvltpaqveeigeidvllvpv
ggtytigpkeakevadllnakviipmhyktkylkfnllpvddflklfdsyervgnilelf
ekpkerkvvvmevq

SCOP Domain Coordinates for d1vjna_:

Click to download the PDB-style file with coordinates for d1vjna_.
(The format of our PDB-style files is described here.)

Timeline for d1vjna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vjnb_