SCOPe 2.05: Domain d1vjlb_: 1vjl B:

Lineage for d1vjlb_ (1vjl B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
   duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet

4. Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family)
   automatically mapped to Pfam PF02577

5. Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)

6. Protein Hypothetical protein TM0160 [103258] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103259] (2 PDB entries)

8. Domain d1vjlb_: 1vjl B: [100823]
   structural genomics
   complexed with cl, unl

Details for d1vjlb_

PDB Entry: 1vjl, 1.9 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (B:) hypothetical protein TM0160

SCOPe Domain Sequences for d1vjlb_:

Sequence, based on SEQRES records:

>d1vjlb_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil
avktgapifvsdnlvekhsiel

Sequence, based on observed residues (ATOM records):

>d1vjlb_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktg
apifvsdnlvekhsiel

Timeline for d1vjlb_:

• d1vjlb_ first appeared in SCOP 1.67
  
• d1vjlb_ appears in SCOPe 2.04
  
• d1vjlb_ is called d1vjlb1 in SCOPe 2.06
  
• d1vjlb_ appears in the current release, SCOPe 2.08, called d1vjlb1