Lineage for d1vjlb_ (1vjl B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052316Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
    duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet
  4. 1052317Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) (S)
  5. 1052318Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)
  6. 1052319Protein Hypothetical protein TM0160 [103258] (1 species)
  7. 1052320Species Thermotoga maritima [TaxId:2336] [103259] (2 PDB entries)
  8. 1052322Domain d1vjlb_: 1vjl B: [100823]
    structural genomics
    complexed with cl, unl

Details for d1vjlb_

PDB Entry: 1vjl (more details), 1.9 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (B:) hypothetical protein TM0160

SCOPe Domain Sequences for d1vjlb_:

Sequence, based on SEQRES records: (download)

>d1vjlb_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil
avktgapifvsdnlvekhsiel

Sequence, based on observed residues (ATOM records): (download)

>d1vjlb_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktg
apifvsdnlvekhsiel

SCOPe Domain Coordinates for d1vjlb_:

Click to download the PDB-style file with coordinates for d1vjlb_.
(The format of our PDB-style files is described here.)

Timeline for d1vjlb_: