Lineage for d1vjlb_ (1vjl B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516777Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
    duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet
  4. 516778Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) (S)
  5. 516779Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)
  6. 516780Protein Hypothetical protein TM0160 [103258] (1 species)
  7. 516781Species Thermotoga maritima [TaxId:243274] [103259] (1 PDB entry)
  8. 516783Domain d1vjlb_: 1vjl B: [100823]
    structural genomics

Details for d1vjlb_

PDB Entry: 1vjl (more details), 1.9 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution

SCOP Domain Sequences for d1vjlb_:

Sequence, based on SEQRES records: (download)

>d1vjlb_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil
avktgapifvsdnlvekhsiel

Sequence, based on observed residues (ATOM records): (download)

>d1vjlb_ d.257.1.1 (B:) Hypothetical protein TM0160 {Thermotoga maritima}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktg
apifvsdnlvekhsiel

SCOP Domain Coordinates for d1vjlb_:

Click to download the PDB-style file with coordinates for d1vjlb_.
(The format of our PDB-style files is described here.)

Timeline for d1vjlb_: