![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily) duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet |
![]() | Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) ![]() automatically mapped to Pfam PF02577 |
![]() | Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein) |
![]() | Protein Hypothetical protein TM0160 [103258] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries) |
![]() | Domain d1vjla1: 1vjl A:1-150 [100822] Other proteins in same PDB: d1vjla2, d1vjlb2 structural genomics complexed with cl, unl |
PDB Entry: 1vjl (more details), 1.9 Å
SCOPe Domain Sequences for d1vjla1:
Sequence, based on SEQRES records: (download)
>d1vjla1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]} mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila vktgapifvsdnlvekhsielevnerdlin
>d1vjla1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]} mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl llsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapif vsdnlvekhsielevnerdlin
Timeline for d1vjla1: