Lineage for d1vjla_ (1vjl A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheetSuperfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) 
automatically mapped to Pfam PF02577Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein) Protein Hypothetical protein TM0160 [103258] (1 species) Species Thermotoga maritima [TaxId:2336] [103259] (2 PDB entries) 
Domain d1vjla_: 1vjl A: [100822]
structural genomics
complexed with cl, unl
Details for d1vjla_
PDB Entry: 1vjl (more details), 1.9 Å
PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (A:) hypothetical protein TM0160SCOPe Domain Sequences for d1vjla_:
Sequence, based on SEQRES records: (download)
>d1vjla_ d.257.1.1 (A:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil
avktgapifvsdnlvekhsielevnerdlin
Sequence, based on observed residues (ATOM records): (download)
>d1vjla_ d.257.1.1 (A:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapi
fvsdnlvekhsielevnerdlin
SCOPe Domain Coordinates for d1vjla_:
Click to download the PDB-style file with coordinates for d1vjla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vjla_:
- d1vjla_ first appeared in SCOP 1.67
- d1vjla_ appears in SCOPe 2.04
- d1vjla_ is called d1vjla1 in SCOPe 2.06
- d1vjla_ appears in the current release, SCOPe 2.08, called d1vjla1
View in 3D
