SCOPe 2.01: Domain d1vjla_: 1vjl A:

Lineage for d1vjla_ (1vjl A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
   duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet

4. Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family)

5. Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)

6. Protein Hypothetical protein TM0160 [103258] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103259] (2 PDB entries)

8. Domain d1vjla_: 1vjl A: [100822]
   structural genomics
   complexed with cl, unl

Details for d1vjla_

PDB Entry: 1vjl, 1.9 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (A:) hypothetical protein TM0160

SCOPe Domain Sequences for d1vjla_:

Sequence, based on SEQRES records:

>d1vjla_ d.257.1.1 (A:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil
avktgapifvsdnlvekhsielevnerdlin

Sequence, based on observed residues (ATOM records):

>d1vjla_ d.257.1.1 (A:) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd
lllsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapi
fvsdnlvekhsielevnerdlin

Timeline for d1vjla_:

• d1vjla_ first appeared in SCOP 1.67
  
• d1vjla_ appears in SCOP 1.75
  
• d1vjla_ appears in SCOPe 2.02
  
• d1vjla_ appears in the current release, SCOPe 2.08, called d1vjla1