![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily) duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet |
![]() | Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) ![]() |
![]() | Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein) |
![]() | Protein Hypothetical protein TM0160 [103258] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [103259] (1 PDB entry) |
![]() | Domain d1vjla_: 1vjl A: [100822] |
PDB Entry: 1vjl (more details), 1.9 Å
SCOP Domain Sequences for d1vjla_:
Sequence, based on SEQRES records: (download)
>d1vjla_ d.257.1.1 (A:) Hypothetical protein TM0160 {Thermotoga maritima} hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd lllsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiil avktgapifvsdnlvekhsielevnerdlin
>d1vjla_ d.257.1.1 (A:) Hypothetical protein TM0160 {Thermotoga maritima} hmrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthd lllsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapi fvsdnlvekhsielevnerdlin
Timeline for d1vjla_: