Lineage for d1vjla1 (1vjl A:1-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009019Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
    duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet
  4. 3009020Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) (S)
    automatically mapped to Pfam PF02577
  5. 3009021Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)
  6. 3009022Protein Hypothetical protein TM0160 [103258] (1 species)
  7. 3009023Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries)
  8. 3009026Domain d1vjla1: 1vjl A:1-150 [100822]
    Other proteins in same PDB: d1vjla2, d1vjlb2
    structural genomics
    complexed with cl, unl

Details for d1vjla1

PDB Entry: 1vjl (more details), 1.9 Å

PDB Description: crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (A:) hypothetical protein TM0160

SCOPe Domain Sequences for d1vjla1:

Sequence, based on SEQRES records: (download)

>d1vjla1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila
vktgapifvsdnlvekhsielevnerdlin

Sequence, based on observed residues (ATOM records): (download)

>d1vjla1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapif
vsdnlvekhsielevnerdlin

SCOPe Domain Coordinates for d1vjla1:

Click to download the PDB-style file with coordinates for d1vjla1.
(The format of our PDB-style files is described here.)

Timeline for d1vjla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjla2