Lineage for d1vjia_ (1vji A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080008Protein 12-oxophytodienoate reductase (OPR, OYE homolog) [63896] (3 species)
  7. 2080009Species Thale cress (Arabidopsis thaliana), OPR1 [TaxId:3702] [102040] (1 PDB entry)
    At1G76680
  8. 2080010Domain d1vjia_: 1vji A: [100813]
    structural genomics
    complexed with fmn

Details for d1vjia_

PDB Entry: 1vji (more details), 2 Å

PDB Description: gene product of at1g76680 from arabidopsis thaliana
PDB Compounds: (A:) 12-oxophytodienoate reductase (OPR1)

SCOPe Domain Sequences for d1vjia_:

Sequence, based on SEQRES records: (download)

>d1vjia_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR1 [TaxId: 3702]}
svplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfliteatgvs
dtaqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqpngkapisc
sdkplmpqirsngidealftpprrlgieeipgivndfrlaarnameagfdgveihgangy
lidqfmkdtvndrtdeyggslqnrckfpleivdavakeigpdrvgirlspfadymesgdt
npgalglymaeslnkygilychviearmktmgevhacphtlmpmrkafkgtfisaggftr
edgneavskgrtdlvaygrwflanpdlpkrfqvdaplnkydrptfytsdpvvgytdypfl
e

Sequence, based on observed residues (ATOM records): (download)

>d1vjia_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR1 [TaxId: 3702]}
svplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfliteatgvs
dtaqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqpngkapisc
sdkplmpqirsngidealftpprrlgieeipgivndfrlaarnameagfdgveihgangy
lidqfmkdtvndrtdeyggslqnrckfpleivdavakeigpdrvgirlspfadymesgdt
npgalglymaeslnkygilychviearmhtlmpmrkafkgtfisaggftredgneavskg
rtdlvaygrwflanpdlpkrfqvdaplnkydrptfytsdpvvgytdypfle

SCOPe Domain Coordinates for d1vjia_:

Click to download the PDB-style file with coordinates for d1vjia_.
(The format of our PDB-style files is described here.)

Timeline for d1vjia_: