SCOP 1.73: Domain d1vjhb_: 1vjh B:

Lineage for d1vjhb_ (1vjh B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)

6. Protein Hypothetical protein At1G24000 [103251] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)

8. Domain d1vjhb_: 1vjh B: [100812]
   structural genomics

Details for d1vjhb_

PDB Entry: 1vjh, 2.1 Å

PDB Description: crystal structure of gene product of at1g24000 from arabidopsis thaliana

PDB Compounds: (B:) Bet v I allergen family

SCOP Domain Sequences for d1vjhb_:

Sequence; same for both SEQRES and ATOM records:

>d1vjhb_ d.129.3.1 (B:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

Timeline for d1vjhb_:

• d1vjhb_ first appeared in SCOP 1.67
  
• d1vjhb_ appears in SCOP 1.71
  
• d1vjhb_ appears in SCOP 1.75
  
• d1vjhb_ appears in the current release, SCOPe 2.08, called d1vjhb1