SCOPe 2.08: Domain d1vjhb1: 1vjh B:2-120

Lineage for d1vjhb1 (1vjh B:2-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Hypothetical protein At1G24000 [103251] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)

8. Domain d1vjhb1: 1vjh B:2-120 [100812]
   Other proteins in same PDB: d1vjha2, d1vjhb2
   structural genomics

Details for d1vjhb1

PDB Entry: 1vjh, 2.1 Å

PDB Description: crystal structure of gene product of at1g24000 from arabidopsis thaliana

PDB Compounds: (B:) Bet v I allergen family

SCOPe Domain Sequences for d1vjhb1:

Sequence; same for both SEQRES and ATOM records:

>d1vjhb1 d.129.3.1 (B:2-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqk
yfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

Timeline for d1vjhb1:

• d1vjhb1 first appeared in SCOP 1.67, called d1vjhb_
  
• d1vjhb1 appears in SCOPe 2.07