![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein Hypothetical protein At1G24000 [103251] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries) |
![]() | Domain d1vjhb1: 1vjh B:2-120 [100812] Other proteins in same PDB: d1vjha2, d1vjhb2 structural genomics |
PDB Entry: 1vjh (more details), 2.1 Å
SCOPe Domain Sequences for d1vjhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjhb1 d.129.3.1 (B:2-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} tlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqk yfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
Timeline for d1vjhb1: