Lineage for d1vjha_ (1vjh A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418378Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 418379Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins)
  6. 418380Protein Hypothetical protein At1G24000 [103251] (1 species)
  7. 418381Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (1 PDB entry)
  8. 418382Domain d1vjha_: 1vjh A: [100811]

Details for d1vjha_

PDB Entry: 1vjh (more details), 2.1 Å

PDB Description: crystal structure of gene product of at1g24000 from arabidopsis thaliana

SCOP Domain Sequences for d1vjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana)}
stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

SCOP Domain Coordinates for d1vjha_:

Click to download the PDB-style file with coordinates for d1vjha_.
(The format of our PDB-style files is described here.)

Timeline for d1vjha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vjhb_