Lineage for d1vjha1 (1vjh A:2-120)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539013Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2539014Protein Hypothetical protein At1G24000 [103251] (1 species)
  7. 2539015Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)
  8. 2539018Domain d1vjha1: 1vjh A:2-120 [100811]
    Other proteins in same PDB: d1vjha2, d1vjhb2
    structural genomics

Details for d1vjha1

PDB Entry: 1vjh (more details), 2.1 Å

PDB Description: crystal structure of gene product of at1g24000 from arabidopsis thaliana
PDB Compounds: (A:) Bet v I allergen family

SCOPe Domain Sequences for d1vjha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjha1 d.129.3.1 (A:2-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqk
yfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

SCOPe Domain Coordinates for d1vjha1:

Click to download the PDB-style file with coordinates for d1vjha1.
(The format of our PDB-style files is described here.)

Timeline for d1vjha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjha2