SCOPe 2.06: Domain d1vjga_: 1vjg A:

Lineage for d1vjga_ (1vjg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein)
   automatically mapped to Pfam PF13472
   automatically mapped to Pfam PF00657

6. Protein Hypothetical protein alr1529 [102241] (1 species)
   putative lipase

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [102242] (2 PDB entries)

8. Domain d1vjga_: 1vjg A: [100810]

Details for d1vjga_

PDB Entry: 1vjg, 2.01 Å

PDB Description: Crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.01 A resolution

PDB Compounds: (A:) putative lipase from the G-D-S-L family

SCOPe Domain Sequences for d1vjga_:

Sequence; same for both SEQRES and ATOM records:

>d1vjga_ c.23.10.6 (A:) Hypothetical protein alr1529 {Nostoc sp. PCC 7120 [TaxId: 103690]}
sktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrw
lqevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmis
papyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpq
aggytefarivenwdawlnwf

Timeline for d1vjga_:

• d1vjga_ first appeared in SCOP 1.67
  
• d1vjga_ appears in SCOPe 2.05
  
• d1vjga_ appears in SCOPe 2.07
  
• d1vjga_ appears in the current release, SCOPe 2.08