Lineage for d1vjga_ (1vjg A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391354Superfamily c.23.10: SGNH hydrolase [52266] (6 families) (S)
  5. 391392Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein)
  6. 391393Protein Hypothetical protein alr1529 [102241] (1 species)
    putative lipase
  7. 391394Species Nostoc sp. pcc 7120 [TaxId:103690] [102242] (1 PDB entry)
  8. 391395Domain d1vjga_: 1vjg A: [100810]

Details for d1vjga_

PDB Entry: 1vjg (more details), 2.01 Å

PDB Description: Crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.01 A resolution

SCOP Domain Sequences for d1vjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjga_ c.23.10.6 (A:) Hypothetical protein alr1529 {Nostoc sp. pcc 7120}
sktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrw
lqevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmis
papyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpq
aggytefarivenwdawlnwf

SCOP Domain Coordinates for d1vjga_:

Click to download the PDB-style file with coordinates for d1vjga_.
(The format of our PDB-style files is described here.)

Timeline for d1vjga_: