Lineage for d1vjfa_ (1vjf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972065Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2972066Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2972067Family d.116.1.1: YbaK/ProRS associated domain [55827] (4 proteins)
    Pfam PF04073
  6. 2972076Protein Hypothetical protein CC0111 [103220] (1 species)
    annotated as putative DNA-binding protein
  7. 2972077Species Caulobacter crescentus [TaxId:155892] [103221] (2 PDB entries)
  8. 2972078Domain d1vjfa_: 1vjf A: [100809]
    structural genomics
    complexed with cl, gol

Details for d1vjfa_

PDB Entry: 1vjf (more details), 1.62 Å

PDB Description: crystal structure of a putative dna-binding protein (cc_0111) from caulobacter crescentus cb15 at 1.62 a resolution
PDB Compounds: (A:) DNA-binding protein, putative

SCOPe Domain Sequences for d1vjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjfa_ d.116.1.1 (A:) Hypothetical protein CC0111 {Caulobacter crescentus [TaxId: 155892]}
mktradlfaffdahgvdhktldhppvfrveegleikaampgghtknlflkdakgqlwlis
algettidlkklhhvigsgrlsfgpqemmletlgvtpgsvtafglindtekrvrfvldka
ladsdpvnfhplkndattavsqaglrrflaalgvepmivdfaamevvg

SCOPe Domain Coordinates for d1vjfa_:

Click to download the PDB-style file with coordinates for d1vjfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vjfa_: