![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins) contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1) automatically mapped to Pfam PF02664 |
![]() | Protein Autoinducer-2 production protein LuxS [64295] (5 species) S-ribosylhomocysteinase |
![]() | Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries) |
![]() | Domain d1vjeb_: 1vje B: [100808] structural genomics complexed with mse, zn |
PDB Entry: 1vje (more details), 1.64 Å
SCOPe Domain Sequences for d1vjeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjeb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]} vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg nyrdhdlaaarqhardvldqglkvqetill
Timeline for d1vjeb_: