SCOPe 2.05: Domain d1vjeb_: 1vje B:

Lineage for d1vjeb_ (1vje B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
   automatically mapped to Pfam PF02664

6. Protein Autoinducer-2 production protein LuxS [64295] (5 species)
   S-ribosylhomocysteinase

7. Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries)

8. Domain d1vjeb_: 1vje B: [100808]
   structural genomics
   complexed with mse, zn

Details for d1vjeb_

PDB Entry: 1vje, 1.64 Å

PDB Description: crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine

PDB Compounds: (B:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1vjeb_:

Sequence; same for both SEQRES and ATOM records:

>d1vjeb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]}
vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
nyrdhdlaaarqhardvldqglkvqetill

Timeline for d1vjeb_:

• d1vjeb_ first appeared in SCOP 1.67
  
• d1vjeb_ appears in SCOPe 2.04
  
• d1vjeb_ appears in SCOPe 2.06
  
• d1vjeb_ appears in the current release, SCOPe 2.08