Lineage for d1vjca_ (1vjc A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402789Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 402790Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 402791Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
    Domain 2 binds ATP
  6. 402792Protein Phosphoglycerate kinase [53750] (7 species)
  7. 402803Species Pig (Sus scrofa) [TaxId:9823] [64177] (4 PDB entries)
  8. 402806Domain d1vjca_: 1vjc A: [100805]
    complexed with atp, mg

Details for d1vjca_

PDB Entry: 1vjc (more details), 2.1 Å

PDB Description: Structure of pig muscle PGK complexed with MgATP

SCOP Domain Sequences for d1vjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjca_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa)}
slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaaipsikfcldngaksvvlm
shlgrpdgipmpdkyslepvavelksllgkdvlflkdcvgpevekacadpaagsvillen
lrfhveeegkgkdasgskvkadpakieafraslsklgdvyvndafgtahrahssmvgvnl
pkkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
ftflkvlnnmeigtslfdeegskivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
tvasgipagwmgldcgpesskkyseavarakqivwngpvgvfeweafaqgtkalmdevvk
atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv

SCOP Domain Coordinates for d1vjca_:

Click to download the PDB-style file with coordinates for d1vjca_.
(The format of our PDB-style files is described here.)

Timeline for d1vjca_: