Lineage for d1vj7b2 (1vj7 B:197-370)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944794Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1944795Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1945170Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins)
    Pfam PF04607; ppGpp-synthetase
  6. 1945175Protein Stringent response-like protein RelA domain 2 [102946] (1 species)
  7. 1945176Species Streptococcus equisimilis [TaxId:119602] [102947] (1 PDB entry)
  8. 1945178Domain d1vj7b2: 1vj7 B:197-370 [100804]
    Other proteins in same PDB: d1vj7a1, d1vj7b1
    complexed with gdp, gpx, mn

Details for d1vj7b2

PDB Entry: 1vj7 (more details), 2.1 Å

PDB Description: Crystal structure of the bifunctional catalytic fragment of RelSeq, the RelA/SpoT homolog from Streptococcus equisimilis.
PDB Compounds: (B:) Bifunctional RELA/SPOT

SCOPe Domain Sequences for d1vj7b2:

Sequence, based on SEQRES records: (download)

>d1vj7b2 d.218.1.8 (B:197-370) Stringent response-like protein RelA domain 2 {Streptococcus equisimilis [TaxId: 119602]}
etefykishmmnekrrerealvddivtkiksytteqglfgdvygrpkhiysiyrkmrdkk
krfdqifdliaircvmetqsdvyamvgyihelwrpmpgrfkdyiaapkangyqsihttvy
gpkgpieiqirtkemhqvaeygvaahwaykkgvrgkvnqaeqkvgmnwikelve

Sequence, based on observed residues (ATOM records): (download)

>d1vj7b2 d.218.1.8 (B:197-370) Stringent response-like protein RelA domain 2 {Streptococcus equisimilis [TaxId: 119602]}
etefykishmmneklvddivtkiksytteqglfgdvygrpkhiysiyrkmrifdliairc
vmetqsdvyamvgyihelwrpmpgrfkdyiaapkangyqsihttvygpkgpieiqirtke
mhqvaeygvawikelve

SCOPe Domain Coordinates for d1vj7b2:

Click to download the PDB-style file with coordinates for d1vj7b2.
(The format of our PDB-style files is described here.)

Timeline for d1vj7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vj7b1