Lineage for d1vj7b1 (1vj7 B:5-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014886Protein Stringent response-like protein RelA N-terminal domain [101341] (1 species)
  7. 2014887Species Streptococcus equisimilis [TaxId:119602] [101342] (1 PDB entry)
  8. 2014889Domain d1vj7b1: 1vj7 B:5-196 [100803]
    Other proteins in same PDB: d1vj7a2, d1vj7b2
    complexed with gdp, gpx, mn

Details for d1vj7b1

PDB Entry: 1vj7 (more details), 2.1 Å

PDB Description: Crystal structure of the bifunctional catalytic fragment of RelSeq, the RelA/SpoT homolog from Streptococcus equisimilis.
PDB Compounds: (B:) Bifunctional RELA/SPOT

SCOPe Domain Sequences for d1vj7b1:

Sequence, based on SEQRES records: (download)

>d1vj7b1 a.211.1.1 (B:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]}
inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeqlaenh
rkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrik
weledlafryln

Sequence, based on observed residues (ATOM records): (download)

>d1vj7b1 a.211.1.1 (B:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]}
inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveskdirvilvkla
drlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrikweledlafryln

SCOPe Domain Coordinates for d1vj7b1:

Click to download the PDB-style file with coordinates for d1vj7b1.
(The format of our PDB-style files is described here.)

Timeline for d1vj7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vj7b2