Lineage for d1vj7a1 (1vj7 A:5-196)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362536Fold a.201: HD domain [101338] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 362537Superfamily a.201.1: HD domain [101339] (1 family) (S)
  5. 362538Family a.201.1.1: HD domain [101340] (1 protein)
    Pfam 01966; metal dependent phosphohydrolases
  6. 362539Protein Stringent response-like protein RelA N-terminal domain [101341] (1 species)
  7. 362540Species Streptococcus equisimilis [TaxId:119602] [101342] (1 PDB entry)
  8. 362541Domain d1vj7a1: 1vj7 A:5-196 [100801]
    Other proteins in same PDB: d1vj7a2, d1vj7b2

Details for d1vj7a1

PDB Entry: 1vj7 (more details), 2.1 Å

PDB Description: Crystal structure of the bifunctional catalytic fragment of RelSeq, the RelA/SpoT homolog from Streptococcus equisimilis.

SCOP Domain Sequences for d1vj7a1:

Sequence, based on SEQRES records: (download)

>d1vj7a1 a.201.1.1 (A:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis}
inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeqlaenh
rkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrik
weledlafryln

Sequence, based on observed residues (ATOM records): (download)

>d1vj7a1 a.201.1.1 (A:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis}
inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklghrkmlmamskdirvi
lvkladrlhnmrtlkqerisretmeiyaplahrlgisrikweledlafryln

SCOP Domain Coordinates for d1vj7a1:

Click to download the PDB-style file with coordinates for d1vj7a1.
(The format of our PDB-style files is described here.)

Timeline for d1vj7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vj7a2