Lineage for d1vj5a2 (1vj5 A:226-547)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400671Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 400672Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 400948Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 400958Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 400959Species Human (Homo sapiens) [TaxId:9606] [102626] (2 PDB entries)
  8. 400960Domain d1vj5a2: 1vj5 A:226-547 [100800]
    Other proteins in same PDB: d1vj5a1
    complexed with ciu, mg, p6g, po4

Details for d1vj5a2

PDB Entry: 1vj5 (more details), 2.35 Å

PDB Description: human soluble epoxide hydrolase- n-cyclohexyl-n'-(4-iodophenyl)urea complex

SCOP Domain Sequences for d1vj5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj5a2 c.69.1.11 (A:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens)}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn

SCOP Domain Coordinates for d1vj5a2:

Click to download the PDB-style file with coordinates for d1vj5a2.
(The format of our PDB-style files is described here.)

Timeline for d1vj5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vj5a1