Lineage for d1vj5a2 (1vj5 A:226-547)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins) 
Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species) Species Human (Homo sapiens) [TaxId:9606] [102626] (2 PDB entries) 
Domain d1vj5a2: 1vj5 A:226-547 [100800]
Other proteins in same PDB: d1vj5a1
complexed with ciu, mg, p6g, po4
Details for d1vj5a2
PDB Entry: 1vj5 (more details), 2.35 Å
PDB Description: human soluble epoxide hydrolase- n-cyclohexyl-n'-(4-iodophenyl)urea complex
SCOP Domain Sequences for d1vj5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vj5a2 c.69.1.11 (A:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens)}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn
SCOP Domain Coordinates for d1vj5a2:
Click to download the PDB-style file with coordinates for d1vj5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vj5a2:
- d1vj5a2 is new in SCOP 1.67
- d1vj5a2 appears in SCOP 1.69
- d1vj5a2 appears in the current release, SCOPe 2.08
View in 3D
