SCOPe 2.06: Domain d1vj3a_: 1vj3 A:

Lineage for d1vj3a_ (1vj3 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)

8. Domain d1vj3a_: 1vj3 A: [100798]
   complexed with ndp, tab

Details for d1vj3a_

PDB Entry: 1vj3, 2.1 Å

PDB Description: structural studies on bio-active compounds. crystal structure and molecular modeling studies on the pneumocystis carinii dihydrofolate reductase cofactor complex with tab, a highly selective antifolate.

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1vj3a_:

Sequence; same for both SEQRES and ATOM records:

>d1vj3a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl

Timeline for d1vj3a_:

• d1vj3a_ first appeared in SCOP 1.67
  
• d1vj3a_ appears in SCOPe 2.05
  
• d1vj3a_ appears in SCOPe 2.07
  
• d1vj3a_ appears in the current release, SCOPe 2.08