SCOP 1.67: Domain d1vj2b_: 1vj2 B:

Lineage for d1vj2b_ (1vj2 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (12 families)

5. Family b.82.1.10: Hypothetical protein TM1459 [101976] (1 protein)

6. Protein Hypothetical protein TM1459 [101977] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [101978] (1 PDB entry)

8. Domain d1vj2b_: 1vj2 B: [100797]
   structural genomics
   complexed with mn, unl

Details for d1vj2b_

PDB Entry: 1vj2, 1.65 Å

PDB Description: crystal structure of a novel family of manganese-containing cupin (tm1459) from thermotoga maritima at 1.65 a resolution

SCOP Domain Sequences for d1vj2b_:

Sequence; same for both SEQRES and ATOM records:

>d1vj2b_ b.82.1.10 (B:) Hypothetical protein TM1459 {Thermotoga maritima}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Timeline for d1vj2b_:

• d1vj2b_ is new in SCOP 1.67
  
• d1vj2b_ appears in SCOP 1.69
  
• d1vj2b_ appears in the current release, SCOPe 2.08