Lineage for d1vj1a2 (1vj1 A:125-311)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841358Protein Putative zinc-binding alcohol dehydrogenase [102131] (1 species)
  7. 2841359Species Mouse (Mus musculus) [TaxId:10090] [102132] (1 PDB entry)
  8. 2841360Domain d1vj1a2: 1vj1 A:125-311 [100795]
    Other proteins in same PDB: d1vj1a1, d1vj1a3
    structural genomics

Details for d1vj1a2

PDB Entry: 1vj1 (more details), 2.1 Å

PDB Description: Crystal structure of putative NADPH-dependent oxidoreductase from Mus musculus at 2.10 A resolution
PDB Compounds: (A:) putative NADPH-dependent oxidoreductase

SCOPe Domain Sequences for d1vj1a2:

Sequence, based on SEQRES records: (download)

>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
hlsyflgaigmpgltsligvqekghisagsnqtmvvsgaagacgslagqighllgcsrvv
gicgtqekclfltselgfdaavnyktgnvaeqlreacpggvdvyfdnvggdisntvisqm
nenshiilcgqisqynkdvpyppplppaveairkernitrerftvlnykdkfepgilqls
qwfkegk

Sequence, based on observed residues (ATOM records): (download)

>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
hlsyflgaigmpgltsligvqekghisagsnqtmvvsgaagacgslagqighllgcsrvv
gicgtqekclfltselgfdaavnyktgnvaeqlreacpggvdvyfdnvggdisntvisqm
nenshiilcppplppaveairkernitrerftvlnykdkfepgilqlsqwfkegk

SCOPe Domain Coordinates for d1vj1a2:

Click to download the PDB-style file with coordinates for d1vj1a2.
(The format of our PDB-style files is described here.)

Timeline for d1vj1a2: