Lineage for d1vj1a1 (1vj1 A:-1-124,A:312-351)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558428Protein Putative zinc-binding alcohol dehydrogenase [101711] (1 species)
  7. 558429Species Mouse (Mus musculus) [TaxId:10090] [101712] (1 PDB entry)
  8. 558430Domain d1vj1a1: 1vj1 A:-1-124,A:312-351 [100794]
    Other proteins in same PDB: d1vj1a2
    structural genomics

Details for d1vj1a1

PDB Entry: 1vj1 (more details), 2.1 Å

PDB Description: Crystal structure of putative NADPH-dependent oxidoreductase from Mus musculus at 2.10 A resolution

SCOP Domain Sequences for d1vj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj1a1 b.35.1.2 (A:-1-124,A:312-351) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus)}
hhmiiqrvvlnsrpgkngnpvaenfrveefslldalnegqvqvrtlylsvdpymrckmne
dtgtdylapwqlaqvadgggigiveeskhqklakgdfvtsfywpwqtkaildgnglekvd
pqlvdgXlkvketvakglenmgvafqsmmtggnvgkqivcisedssl

SCOP Domain Coordinates for d1vj1a1:

Click to download the PDB-style file with coordinates for d1vj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1vj1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vj1a2