SCOP 1.67: Domain d1vj1a1: 1vj1 A:-1-124,A:312-351

Lineage for d1vj1a1 (1vj1 A:-1-124,A:312-351)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Putative zinc-binding alcohol dehydrogenase [101711] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101712] (1 PDB entry)

8. Domain d1vj1a1: 1vj1 A:-1-124,A:312-351 [100794]
   Other proteins in same PDB: d1vj1a2
   structural genomics

Details for d1vj1a1

PDB Entry: 1vj1, 2.1 Å

PDB Description: Crystal structure of putative NADPH-dependent oxidoreductase from Mus musculus at 2.10 A resolution

SCOP Domain Sequences for d1vj1a1:

Sequence; same for both SEQRES and ATOM records:

>d1vj1a1 b.35.1.2 (A:-1-124,A:312-351) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus)}
hhmiiqrvvlnsrpgkngnpvaenfrveefslldalnegqvqvrtlylsvdpymrckmne
dtgtdylapwqlaqvadgggigiveeskhqklakgdfvtsfywpwqtkaildgnglekvd
pqlvdgXlkvketvakglenmgvafqsmmtggnvgkqivcisedssl

Timeline for d1vj1a1:

• d1vj1a1 is new in SCOP 1.67
  
• d1vj1a1 appears in SCOP 1.69
  
• d1vj1a1 appears in the current release, SCOPe 2.08