Lineage for d1vj0a2 (1vj0 A:156-337)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574380Protein Hypothetical protein TM0436 [102124] (1 species)
  7. 574381Species Thermotoga maritima [TaxId:243274] [102125] (1 PDB entry)
  8. 574382Domain d1vj0a2: 1vj0 A:156-337 [100787]
    Other proteins in same PDB: d1vj0a1, d1vj0b1, d1vj0c1, d1vj0d1

Details for d1vj0a2

PDB Entry: 1vj0 (more details), 2 Å

PDB Description: crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution

SCOP Domain Sequences for d1vj0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima}
ddldvlamamcsgatayhafdeypesfagktvviqgagplglfgvviarslgaenvivia
gspnrlklaeeigadltlnrretsveerrkaimdithgrgadfileatgdsrallegsel
lrrggfysvagvavpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqlls
kl

SCOP Domain Coordinates for d1vj0a2:

Click to download the PDB-style file with coordinates for d1vj0a2.
(The format of our PDB-style files is described here.)

Timeline for d1vj0a2: