Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins) N-terminal all-beta domain defines family |
Protein Hypothetical protein TM0436 [102124] (1 species) |
Species Thermotoga maritima [TaxId:243274] [102125] (1 PDB entry) |
Domain d1vj0a2: 1vj0 A:156-337 [100787] Other proteins in same PDB: d1vj0a1, d1vj0b1, d1vj0c1, d1vj0d1 |
PDB Entry: 1vj0 (more details), 2 Å
SCOP Domain Sequences for d1vj0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima} ddldvlamamcsgatayhafdeypesfagktvviqgagplglfgvviarslgaenvivia gspnrlklaeeigadltlnrretsveerrkaimdithgrgadfileatgdsrallegsel lrrggfysvagvavpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqlls kl
Timeline for d1vj0a2: