SCOP 1.67: Domain d1vj0a2: 1vj0 A:156-337

Lineage for d1vj0a2 (1vj0 A:156-337)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins)
   N-terminal all-beta domain defines family

6. Protein Hypothetical protein TM0436 [102124] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [102125] (1 PDB entry)

8. Domain d1vj0a2: 1vj0 A:156-337 [100787]
   Other proteins in same PDB: d1vj0a1, d1vj0b1, d1vj0c1, d1vj0d1

Details for d1vj0a2

PDB Entry: 1vj0, 2 Å

PDB Description: crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution

SCOP Domain Sequences for d1vj0a2:

Sequence; same for both SEQRES and ATOM records:

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima}
ddldvlamamcsgatayhafdeypesfagktvviqgagplglfgvviarslgaenvivia
gspnrlklaeeigadltlnrretsveerrkaimdithgrgadfileatgdsrallegsel
lrrggfysvagvavpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqlls
kl

Timeline for d1vj0a2:

• d1vj0a2 is new in SCOP 1.67
  
• d1vj0a2 appears in SCOP 1.69
  
• d1vj0a2 appears in the current release, SCOPe 2.08