Lineage for d1vizb1 (1viz B:2-226)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828233Protein PcrB protein homolog YerE [102046] (2 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 2828234Species Bacillus subtilis [TaxId:1423] [102047] (5 PDB entries)
  8. 2828242Domain d1vizb1: 1viz B:2-226 [100785]
    Other proteins in same PDB: d1viza2, d1vizb2
    structural genomics
    complexed with na

Details for d1vizb1

PDB Entry: 1viz (more details), 1.85 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (B:) PcrB protein homolog

SCOPe Domain Sequences for d1vizb1:

Sequence, based on SEQRES records: (download)

>d1vizb1 c.1.4.1 (B:2-226) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}
ydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflvp
cvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycia
npdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlets
tlfygggikdaetakqyaehadvivvgnavyedfdralktvaavk

Sequence, based on observed residues (ATOM records): (download)

>d1vizb1 c.1.4.1 (B:2-226) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}
ydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggdnvlrmmskvrrflvpcvlevs
aieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycianpdcka
aalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavletstlfygg
gikdaetakqyaehadvivvgnavyedfdralktvaavk

SCOPe Domain Coordinates for d1vizb1:

Click to download the PDB-style file with coordinates for d1vizb1.
(The format of our PDB-style files is described here.)

Timeline for d1vizb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vizb2