Lineage for d1viza_ (1viz A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384012Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 384013Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 384147Protein PcrB protein homolog YerE [102046] (1 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 384148Species Bacillus subtilis [TaxId:1423] [102047] (1 PDB entry)
  8. 384149Domain d1viza_: 1viz A: [100784]

Details for d1viza_

PDB Entry: 1viz (more details), 1.85 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1viza_:

Sequence, based on SEQRES records: (download)

>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis}
slydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrfl
vpcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegyc
ianpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavle
tstlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkge

Sequence, based on observed residues (ATOM records): (download)

>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis}
slydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggtednvlrmmskvrrflvpcv
levsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycianp
dckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavletstl
fygggikdaetakqyaehadvivvgnavyedfdralktvaavkge

SCOP Domain Coordinates for d1viza_:

Click to download the PDB-style file with coordinates for d1viza_.
(The format of our PDB-style files is described here.)

Timeline for d1viza_: