Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Dephospho-CoA kinase [75187] (4 species) |
Species Escherichia coli [TaxId:562] [82394] (5 PDB entries) |
Domain d1viyc1: 1viy C:2-206 [100783] Other proteins in same PDB: d1viya2, d1viya3, d1viyb2, d1viyb3, d1viyc2, d1viyc3 structural genomics complexed with so4 |
PDB Entry: 1viy (more details), 1.89 Å
SCOPe Domain Sequences for d1viyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1viyc1 c.37.1.1 (C:2-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} ryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaa dgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensly kkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapda iasdvarlhahylqlasqfvsqekp
Timeline for d1viyc1: