Lineage for d1viyc1 (1viy C:2-206)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474150Protein Dephospho-CoA kinase [75187] (4 species)
  7. 2474151Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)
  8. 2474163Domain d1viyc1: 1viy C:2-206 [100783]
    Other proteins in same PDB: d1viya2, d1viya3, d1viyb2, d1viyb3, d1viyc2, d1viyc3
    structural genomics
    complexed with so4

Details for d1viyc1

PDB Entry: 1viy (more details), 1.89 Å

PDB Description: crystal structure of dephospho-coa kinase
PDB Compounds: (C:) dephospho-coa kinase

SCOPe Domain Sequences for d1viyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viyc1 c.37.1.1 (C:2-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
ryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaa
dgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensly
kkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapda
iasdvarlhahylqlasqfvsqekp

SCOPe Domain Coordinates for d1viyc1:

Click to download the PDB-style file with coordinates for d1viyc1.
(The format of our PDB-style files is described here.)

Timeline for d1viyc1: