Lineage for d1viya_ (1viy A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845314Protein Dephospho-CoA kinase [75187] (4 species)
  7. 1845315Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)
  8. 1845322Domain d1viya_: 1viy A: [100781]
    structural genomics
    complexed with so4

Details for d1viya_

PDB Entry: 1viy (more details), 1.89 Å

PDB Description: crystal structure of dephospho-coa kinase
PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d1viya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viya_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmi
aadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvens
lykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngap
daiasdvarlhahylqlasqfvsqekpe

SCOPe Domain Coordinates for d1viya_:

Click to download the PDB-style file with coordinates for d1viya_.
(The format of our PDB-style files is described here.)

Timeline for d1viya_: