| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein Dephospho-CoA kinase [75187] (4 species) |
| Species Escherichia coli [TaxId:562] [82394] (5 PDB entries) |
| Domain d1viya1: 1viy A:2-206 [100781] Other proteins in same PDB: d1viya2, d1viya3, d1viyb2, d1viyb3, d1viyc2, d1viyc3 structural genomics complexed with so4 |
PDB Entry: 1viy (more details), 1.89 Å
SCOPe Domain Sequences for d1viya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1viya1 c.37.1.1 (A:2-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
ryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaa
dgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensly
kkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapda
iasdvarlhahylqlasqfvsqekp
Timeline for d1viya1: