SCOPe 2.08: Domain d1vivb1: 1viv B:2-177

Lineage for d1vivb1 (1viv B:2-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
   dimer of mono-domain subunits

6. Protein Hypothetical protein YckF [82534] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82535] (2 PDB entries)

8. Domain d1vivb1: 1viv B:2-177 [100776]
   Other proteins in same PDB: d1viva2, d1vivb2
   structural genomics

Details for d1vivb1

PDB Entry: 1viv, 2.6 Å

PDB Description: crystal structure of a hypothetical protein

PDB Compounds: (B:) Hypothetical protein yckf

SCOPe Domain Sequences for d1vivb1:

Sequence; same for both SEQRES and ATOM records:

>d1vivb1 c.80.1.3 (B:2-177) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]}
ktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmhm
gfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessigk
qadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetm

Timeline for d1vivb1:

• d1vivb1 first appeared in SCOP 1.67, called d1vivb_
  
• d1vivb1 appears in SCOPe 2.07