![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins) contains N-terminal alpha-L RNA-binding motif |
![]() | Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [103018] (1 PDB entry) |
![]() | Domain d1viob1: 1vio B:58-231 [100764] Other proteins in same PDB: d1vioa2, d1vioa3, d1viob2, d1viob3 structural genomics complexed with bu1 |
PDB Entry: 1vio (more details), 1.59 Å
SCOPe Domain Sequences for d1viob1:
Sequence, based on SEQRES records: (download)
>d1viob1 d.265.1.3 (B:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]} eegqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqw shritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlt isegryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv
>d1viob1 d.265.1.3 (B:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]} eegqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwsh ritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltis egryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv
Timeline for d1viob1: