Lineage for d1viob1 (1vio B:58-231)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615008Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615009Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2615053Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 2615063Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)
  7. 2615068Species Haemophilus influenzae [TaxId:727] [103018] (1 PDB entry)
  8. 2615070Domain d1viob1: 1vio B:58-231 [100764]
    Other proteins in same PDB: d1vioa2, d1vioa3, d1viob2, d1viob3
    structural genomics
    complexed with bu1

Details for d1viob1

PDB Entry: 1vio (more details), 1.59 Å

PDB Description: crystal structure of pseudouridylate synthase
PDB Compounds: (B:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1viob1:

Sequence, based on SEQRES records: (download)

>d1viob1 d.265.1.3 (B:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]}
eegqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqw
shritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlt
isegryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

Sequence, based on observed residues (ATOM records): (download)

>d1viob1 d.265.1.3 (B:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]}
eegqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwsh
ritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltis
egryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

SCOPe Domain Coordinates for d1viob1:

Click to download the PDB-style file with coordinates for d1viob1.
(The format of our PDB-style files is described here.)

Timeline for d1viob1: