Lineage for d1vimc_ (1vim C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592149Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 592150Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 592225Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
    dimer of mono-domain subunits
  6. 592226Protein Hypothetical protein AF1796 [102670] (1 species)
  7. 592227Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry)
  8. 592230Domain d1vimc_: 1vim C: [100760]

Details for d1vimc_

PDB Entry: 1vim (more details), 1.36 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vimc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vimc_ c.80.1.3 (C:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus}
gghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamr
lmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrds
slakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdl
earhavleeg

SCOP Domain Coordinates for d1vimc_:

Click to download the PDB-style file with coordinates for d1vimc_.
(The format of our PDB-style files is described here.)

Timeline for d1vimc_: