![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (3 families) ![]() |
![]() | Family c.80.1.3: mono-SIS domain [69599] (4 proteins) dimer of mono-domain subunits |
![]() | Protein Hypothetical protein AF1796 [102670] (1 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry) |
![]() | Domain d1vimc_: 1vim C: [100760] |
PDB Entry: 1vim (more details), 1.36 Å
SCOP Domain Sequences for d1vimc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vimc_ c.80.1.3 (C:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus} gghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamr lmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrds slakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdl earhavleeg
Timeline for d1vimc_: