Lineage for d1vimc1 (1vim C:2-183)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908254Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
    dimer of mono-domain subunits
  6. 2908255Protein Hypothetical protein AF1796 [102670] (1 species)
  7. 2908256Species Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry)
  8. 2908259Domain d1vimc1: 1vim C:2-183 [100760]
    Other proteins in same PDB: d1vima2, d1vima3, d1vimb2, d1vimb3, d1vimc2, d1vimc3, d1vimd2, d1vimd3
    structural genomics
    complexed with fmt

Details for d1vimc1

PDB Entry: 1vim (more details), 1.36 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (C:) Hypothetical protein AF1796

SCOPe Domain Sequences for d1vimc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vimc1 c.80.1.3 (C:2-183) Hypothetical protein AF1796 {Archaeoglobus fulgidus [TaxId: 2234]}
lrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamrlmhlgy
tvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrdsslakma
dvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdlearhav
le

SCOPe Domain Coordinates for d1vimc1:

Click to download the PDB-style file with coordinates for d1vimc1.
(The format of our PDB-style files is described here.)

Timeline for d1vimc1: