Lineage for d1vimb_ (1vim B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493569Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 493570Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 493630Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
    dimer of mono-domain subunits
  6. 493631Protein Hypothetical protein AF1796 [102670] (1 species)
  7. 493632Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry)
  8. 493634Domain d1vimb_: 1vim B: [100759]

Details for d1vimb_

PDB Entry: 1vim (more details), 1.36 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vimb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vimb_ c.80.1.3 (B:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus}
hmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamrlm
hlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrdssl
akmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdlea
rhavleeg

SCOP Domain Coordinates for d1vimb_:

Click to download the PDB-style file with coordinates for d1vimb_.
(The format of our PDB-style files is described here.)

Timeline for d1vimb_: