SCOP 1.67: Domain d1vimb_: 1vim B:

Lineage for d1vimb_ (1vim B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (3 families)

5. Family c.80.1.3: mono-SIS domain [69599] (4 proteins)
   dimer of mono-domain subunits

6. Protein Hypothetical protein AF1796 [102670] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102671] (1 PDB entry)

8. Domain d1vimb_: 1vim B: [100759]

Details for d1vimb_

PDB Entry: 1vim, 1.36 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vimb_:

Sequence; same for both SEQRES and ATOM records:

>d1vimb_ c.80.1.3 (B:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus}
hmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamrlm
hlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrdssl
akmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdlea
rhavleeg

Timeline for d1vimb_:

• d1vimb_ is new in SCOP 1.67
  
• d1vimb_ appears in SCOP 1.69
  
• d1vimb_ appears in the current release, SCOPe 2.08, called d1vimb1