Lineage for d1vica_ (1vic A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) 
Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species) 
Species Haemophilus influenzae [TaxId:727] [102607] (2 PDB entries) 
Domain d1vica_: 1vic A: [100756]
structural genomics
Details for d1vica_
PDB Entry: 1vic (more details), 1.8 Å
PDB Description: crystal structure of cmp-kdo synthetase
PDB Compounds: (A:) 3-deoxy-manno-octulosonate cytidylyltransferaseSCOPe Domain Sequences for d1vica_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]}
sftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaksf
gaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfnv
nmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsda
ylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdta
edlekvrailaangs
SCOPe Domain Coordinates for d1vica_:
Click to download the PDB-style file with coordinates for d1vica_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vica_:
- d1vica_ first appeared in SCOP 1.67
- d1vica_ appears in SCOPe 2.04
- d1vica_ is called d1vica1 in SCOPe 2.06
- d1vica_ appears in the current release, SCOPe 2.08, called d1vica1
View in 3D
