SCOP 1.67: Domain d1vi9d_: 1vi9 D:

Lineage for d1vi9d_ (1vi9 D:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (2 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein Pyridoxamine kinase [102638] (1 species)

7. Species Escherichia coli [TaxId:562] [102639] (1 PDB entry)

8. Domain d1vi9d_: 1vi9 D: [100753]
   structural genomics
   complexed with bme, so4

Details for d1vi9d_

PDB Entry: 1vi9, 1.96 Å

PDB Description: crystal structure of pyridoxamine kinase

SCOP Domain Sequences for d1vi9d_:

Sequence; same for both SEQRES and ATOM records:

>d1vi9d_ c.72.1.5 (D:) Pyridoxamine kinase {Escherichia coli}
lmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgavmppshl
teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkle

Timeline for d1vi9d_:

• d1vi9d_ is new in SCOP 1.67
  
• d1vi9d_ appears in SCOP 1.69
  
• d1vi9d_ appears in the current release, SCOPe 2.08, called d1vi9d1