Lineage for d1vi9d1 (1vi9 D:2-287)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904548Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2904569Protein Pyridoxamine kinase [102638] (1 species)
  7. 2904570Species Escherichia coli [TaxId:562] [102639] (2 PDB entries)
    Uniprot P77150
  8. 2904576Domain d1vi9d1: 1vi9 D:2-287 [100753]
    Other proteins in same PDB: d1vi9a2, d1vi9a3, d1vi9b2, d1vi9b3, d1vi9c2, d1vi9c3, d1vi9d2, d1vi9d3
    structural genomics
    complexed with bme, so4

Details for d1vi9d1

PDB Entry: 1vi9 (more details), 1.96 Å

PDB Description: crystal structure of pyridoxamine kinase
PDB Compounds: (D:) Pyridoxamine kinase

SCOPe Domain Sequences for d1vi9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi9d1 c.72.1.5 (D:2-287) Pyridoxamine kinase {Escherichia coli [TaxId: 562]}
mknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshlt
eivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpekg
civapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivlv
khlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatlq
ealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl

SCOPe Domain Coordinates for d1vi9d1:

Click to download the PDB-style file with coordinates for d1vi9d1.
(The format of our PDB-style files is described here.)

Timeline for d1vi9d1: