Lineage for d1vi9c_ (1vi9 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401546Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 401547Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 401636Family c.72.1.5: PfkB-like kinase [82515] (2 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 401654Protein Pyridoxamine kinase [102638] (1 species)
  7. 401655Species Escherichia coli [TaxId:562] [102639] (1 PDB entry)
  8. 401658Domain d1vi9c_: 1vi9 C: [100752]

Details for d1vi9c_

PDB Entry: 1vi9 (more details), 1.96 Å

PDB Description: crystal structure of pyridoxamine kinase

SCOP Domain Sequences for d1vi9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi9c_ c.72.1.5 (C:) Pyridoxamine kinase {Escherichia coli}
lmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgavmppshl
teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkle

SCOP Domain Coordinates for d1vi9c_:

Click to download the PDB-style file with coordinates for d1vi9c_.
(The format of our PDB-style files is described here.)

Timeline for d1vi9c_: