![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.5: PfkB-like kinase [82515] (3 proteins) includes a variety of carbohydrate and pyrimidine kinases |
![]() | Protein Pyridoxamine kinase [102638] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102639] (2 PDB entries) Uniprot P77150 |
![]() | Domain d1vi9a1: 1vi9 A:2-287 [100750] Other proteins in same PDB: d1vi9a2, d1vi9a3, d1vi9b2, d1vi9b3, d1vi9c2, d1vi9c3, d1vi9d2, d1vi9d3 structural genomics complexed with bme, so4 |
PDB Entry: 1vi9 (more details), 1.96 Å
SCOPe Domain Sequences for d1vi9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi9a1 c.72.1.5 (A:2-287) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} mknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshlt eivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpekg civapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivlv khlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatlq ealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl
Timeline for d1vi9a1: