SCOP 1.67: Domain d1vi8h_: 1vi8 H:

Lineage for d1vi8h_ (1vi8 H:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (6 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)

8. Domain d1vi8h_: 1vi8 H: [100749]
   structural genomics

Details for d1vi8h_

PDB Entry: 1vi8, 2.2 Å

PDB Description: crystal structure of a putative thioesterase

SCOP Domain Sequences for d1vi8h_:

Sequence; same for both SEQRES and ATOM records:

>d1vi8h_ d.38.1.5 (H:) Hypothetical protein YdiI {Escherichia coli}
sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
dekgrlccssrlttaile

Timeline for d1vi8h_:

• d1vi8h_ is new in SCOP 1.67
  
• d1vi8h_ appears in SCOP 1.69
  
• d1vi8h_ appears in the current release, SCOPe 2.08, called d1vi8h1