SCOPe 2.01: Domain d1vi8e_: 1vi8 E:

Lineage for d1vi8e_ (1vi8 E:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)

8. Domain d1vi8e_: 1vi8 E: [100746]
   structural genomics

Details for d1vi8e_

PDB Entry: 1vi8, 2.2 Å

PDB Description: crystal structure of a putative thioesterase

PDB Compounds: (E:) Hypothetical protein ydiI

SCOPe Domain Sequences for d1vi8e_:

Sequence; same for both SEQRES and ATOM records:

>d1vi8e_ d.38.1.5 (E:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
dekgrlccssrlttaile

Timeline for d1vi8e_:

• d1vi8e_ first appeared in SCOP 1.67
  
• d1vi8e_ appears in SCOP 1.75
  
• d1vi8e_ appears in SCOPe 2.02
  
• d1vi8e_ appears in the current release, SCOPe 2.08, called d1vi8e1